PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vang0206s00010.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family MYB_related
Protein Properties Length: 307aa    MW: 33824.5 Da    PI: 9.6467
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vang0206s00010.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding44.63.3e-143781147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                      r +WT+eE++++++a +++  + Wk+I   +g  +t  q++s+ qky
  Vang0206s00010.1 37 RESWTEEEHDKFLEALQLFDRD-WKKIEDFVG-SKTVIQIRSHAQKY 81
                      789*****************77.*********.*************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.27E-173187IPR009057Homeodomain-like
PROSITE profilePS5129416.2913286IPR017930Myb domain
TIGRFAMsTIGR015579.2E-193584IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.602.9E-73587IPR009057Homeodomain-like
SMARTSM007171.1E-113684IPR001005SANT/Myb domain
PfamPF002497.4E-123781IPR001005SANT/Myb domain
CDDcd001672.45E-93982No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009737Biological Processresponse to abscisic acid
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0032922Biological Processcircadian regulation of gene expression
GO:0043966Biological Processhistone H3 acetylation
GO:0046686Biological Processresponse to cadmium ion
GO:0048573Biological Processphotoperiodism, flowering
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 307 aa     Download sequence    Send to blast
LWRSMNSNTS NSQSMAVAAS DVSGKKVRKP YTITKSRESW TEEEHDKFLE ALQLFDRDWK  60
KIEDFVGSKT VIQIRSHAQK YFLKVQKNGT VAHVPPPRPK RKAAHPYPQK ASKNVLVPLP  120
ASIGYTSTNM LAPGFATWDE TSLLMNTGVS KSMTCQDELN SIRGNEGMRT SFCSDIGSKG  180
ITKITNSILS GVRNSTRTLQ TPEIPKQGKQ APVIHGLPDF AEVYSFIGSV FDPDTNDHVQ  240
KLKEMDPINF ETVLLLMRNL TVNLSSPDFE PIKKALSAYD VNGMAVGVGT GIDVKKQTND  300
LSCQTA*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00338DAPTransfer from AT3G09600Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014491921.10.0PREDICTED: protein REVEILLE 8-like isoform X1
RefseqXP_014491922.10.0PREDICTED: protein REVEILLE 8-like isoform X1
SwissprotQ8RWU31e-129RVE8_ARATH; Protein REVEILLE 8
TrEMBLA0A0S3SST50.0A0A0S3SST5_PHAAN; Uncharacterized protein
STRINGGLYMA13G19910.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF67353449
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G09600.11e-115MYB_related family protein